PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016478803.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13729.6 Da    PI: 10.024
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016478803.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.8e-251059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n   rqvtfskR+ g++KKA+EL +LCda+v v ifsstg+lyeyss
  XP_016478803.1 10 RIDNPASRQVTFSKRKSGLIKKAKELAILCDAQVGVTIFSSTGRLYEYSS 59
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.45161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-35160IPR002100Transcription factor, MADS-box
CDDcd002652.07E-38277No hitNo description
SuperFamilySSF554558.24E-31385IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MARGKIAIRR IDNPASRQVT FSKRKSGLIK KAKELAILCD AQVGVTIFSS TGRLYEYSSS  60
SMKSIFDRYN EEKEHHQLLT PSSAAKLWRT EAERLRQQME DLQENYRFTY YFFQEHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20177177Myocyte-specific enhancer factor 2B
1tqe_Q1e-20177177Myocyte-specific enhancer factor 2B
1tqe_R1e-20177177Myocyte-specific enhancer factor 2B
1tqe_S1e-20177177Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016478803.11e-83PREDICTED: MADS-box transcription factor 23-like isoform X1
SwissprotQ9SZJ61e-47AGL21_ARATH; Agamous-like MADS-box protein AGL21
SwissprotQ6EP492e-47MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLX5DS455e-50X5DS45_COFAR; AGL16
STRINGGLYMA01G02525.12e-48(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.17e-49AGAMOUS-like 21